PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.213510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 278aa    MW: 32150.5 Da    PI: 6.3504
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.213510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46.1e-172774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++ +G g+W+  a+  g++Rt+k+c++rw++yl
   Cucsa.213510.1 27 RGPWTIEEDTLLIRYIAVHGEGQWNILAKQAGLKRTGKSCRLRWLNYL 74
                     89********************************************97 PP

2Myb_DNA-binding50.16.5e-1680123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   Cucsa.213510.1  80 RGNLTLQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 123
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.972274IPR017930Myb domain
SuperFamilySSF466891.72E-3025121IPR009057Homeodomain-like
SMARTSM007177.5E-142676IPR001005SANT/Myb domain
PfamPF002496.9E-162774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-222881IPR009057Homeodomain-like
CDDcd001678.38E-102974No hitNo description
PROSITE profilePS5129424.5875129IPR017930Myb domain
SMARTSM007172.2E-1479127IPR001005SANT/Myb domain
PfamPF002498.3E-1580123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2382129IPR009057Homeodomain-like
CDDcd001675.82E-795123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MISMANLSIK SENYKKAREE EISELRRGPW TIEEDTLLIR YIAVHGEGQW NILAKQAGLK  60
RTGKSCRLRW LNYLKPDVKR GNLTLQEQLL ILELHSKWGN RWSKIAQHLP GRTDNEIKNY  120
WRTRVQKQLR QLKVEANSKR FLDAIHHLSM LEAMDQSSNF SLNFPPPSAL QNTTSPNSFE  180
TAIHPFNDHM GDAAPLRVPC SVSQWPEISQ PPPNSCGEFE EAWRLNMEEM QKQKQEPVCS  240
LGAWEIEDCD VHMAAPDWLM EDSMVENLWS LEDHHLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26221292108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819260.0LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004151034.20.0PREDICTED: myb-related protein 305-like
SwissprotQ9SPG92e-63MYB24_ARATH; Transcription factor MYB24
STRINGVIT_01s0011g03730.t011e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2458633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-62myb domain protein 62